DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and MAZ

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001036004.1 Gene:MAZ / 4150 HGNCID:6914 Length:493 Species:Homo sapiens


Alignment Length:314 Identity:83/314 - (26%)
Similarity:139/314 - (44%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 EEQHKSRGKPYACKICGKDFTRSYHLKRHQK-YSSCSSNETDTMSCKVCDRVFYRLDNLRSHLKQ 401
            |::.||:| ||.|.:|.|:|...|:|:||:. ::...:....:.:.|:...|...|    ..:.|
Human   181 EKKTKSKG-PYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSL----LSVPQ 240

  Fly   402 HLGT----------------------------QVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTGE 438
            ..|.                            :.::| .:.|..|...|..:..||.|..:|:.|
Human   241 LSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRK-NHACEMCGKAFRDVYHLNRHKLSHSDE 304

  Fly   439 KPFDCDLCDKKFSALVALKKHRRYHTG--EKPYSCTVCNQAFAVKEVLNRHMKR-HTGERPHKCD 500
            ||:.|.:|.::|.....:..|.|.|.|  .|||:|:.|.::|:..:.||.|::: |:.|||.||:
Human   305 KPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCE 369

  Fly   501 ECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTP 565
            :|..:|....:||.|:..|....||..|. |..:...:..|:|.||  :.|...|..|.:.|.|.
Human   370 KCEAAFATKDRLRAHTVRHEEKVPCHVCG-KMLSSAYISDHMKVHS--QGPHHVCELCNKGFTTA 431

  Fly   566 ALLKEH--MDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRT 617
            |.|:.|  .|.|..:|:            .:|..|.:|..:..:...|..|::|
Human   432 AYLRIHAVKDHGLQAPR------------ADRILCKLCSVHCKTPAQLAGHMQT 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 57/210 (27%)
C2H2 Zn finger 321..341 CDD:275368 1/2 (50%)
zf-C2H2 348..368 CDD:278523 9/19 (47%)
C2H2 Zn finger 350..368 CDD:275368 8/17 (47%)
C2H2 Zn finger 382..402 CDD:275368 3/19 (16%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..451 CDD:290200 9/22 (41%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..479 CDD:290200 9/25 (36%)
COG5048 <467..620 CDD:227381 46/154 (30%)
C2H2 Zn finger 471..491 CDD:275368 6/20 (30%)
zf-H2C2_2 484..508 CDD:290200 11/24 (46%)
C2H2 Zn finger 499..519 CDD:275368 6/19 (32%)
C2H2 Zn finger 525..545 CDD:275368 5/19 (26%)
C2H2 Zn finger 555..572 CDD:275368 7/18 (39%)
C2H2 Zn finger 598..615 CDD:275371 3/16 (19%)
MAZNP_001036004.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..146
C2H2 Zn finger 192..212 CDD:275368 8/19 (42%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
SFP1 <303..360 CDD:227516 19/56 (34%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
C2H2 Zn finger 339..357 CDD:275368 6/17 (35%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 394..413 CDD:275368 5/19 (26%)
C2H2 Zn finger 421..437 CDD:275368 6/15 (40%)
C2H2 Zn finger 454..474 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.