DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and CG14655

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:439 Identity:115/439 - (26%)
Similarity:169/439 - (38%) Gaps:112/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 CSIC-----NANLRSEALLALHE-----------EQHKSRGKPYACKICGKDFTRSYHLKRHQKY 369
            |.||     |..||...:..:||           :|.:...:||.|.:|.|.|.....|:.|.|.
  Fly   114 CDICEFSFRNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKV 178

  Fly   370 ---------------------SSCSSNETDTMSCKVCDRVF--------------------YRLD 393
                                 :|.:|..|.|....:|||:.                    |.|.
  Fly   179 VHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALS 243

  Fly   394 NLRSHLKQ-----HLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTGEKPFDCDLCDKKFSAL 453
            ...|.|:|     ..||...|..|  |..|...|.:...|..|.|.||||.|:.|::|.:.|:..
  Fly   244 GALSMLQQSPSSPESGTATPKLWE--CDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQ 306

  Fly   454 VALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKT 518
            .:..||..||:..||:.|.||.:||.....|:.|.:.|:||:|.||:.|||.|.|......|::.
  Fly   307 QSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRI 371

  Fly   519 H--IRPFPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAEC-KRNFRTPALLKEHMDEG--KHS 578
            |  :.|:.||.|.:.|:        .|...||.|       | ....:||..|.:...||  .|:
  Fly   372 HTGVMPYKCELCQKTFR--------YKVSQRTHR-------CPTEEAQTPEQLIKAFLEGNDSHT 421

  Fly   579 PKQQRSSMRSAV---KIMERTDCAICDKNFDSSDTLRRHIRTVHECDPDDIFGVEPHPSKRAKKD 640
            .....|:..:|:   .|::....|:..::.|..        .|.:|....|.||||    |.:..
  Fly   422 QPSPASAEIAAINSSSIVDPEQEALLSQSIDDI--------VVEQCQKLGICGVEP----REEGQ 474

  Fly   641 IESEEVVPVALNTSAGSLIS----------SQTD---GNGVVVREFLVD 676
            :.|.:.|.|...:..||.:.          .||:   .:|.|.:.||:|
  Fly   475 LISLQPVAVVHFSGNGSPLQQLQNLRIYSPQQTELPSSDGEVFQRFLMD 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 73/257 (28%)
C2H2 Zn finger 321..341 CDD:275368 8/35 (23%)
zf-C2H2 348..368 CDD:278523 7/19 (37%)
C2H2 Zn finger 350..368 CDD:275368 6/17 (35%)
C2H2 Zn finger 382..402 CDD:275368 8/44 (18%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..451 CDD:290200 10/22 (45%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..479 CDD:290200 10/23 (43%)
COG5048 <467..620 CDD:227381 44/160 (28%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
zf-H2C2_2 484..508 CDD:290200 12/23 (52%)
C2H2 Zn finger 499..519 CDD:275368 7/19 (37%)
C2H2 Zn finger 525..545 CDD:275368 5/19 (26%)
C2H2 Zn finger 555..572 CDD:275368 4/17 (24%)
C2H2 Zn finger 598..615 CDD:275371 2/16 (13%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 281..304 CDD:290200 10/22 (45%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 364..389 CDD:290200 7/32 (22%)
C2H2 Zn finger 380..396 CDD:275368 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.