DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and Neu2

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:374 Identity:93/374 - (24%)
Similarity:147/374 - (39%) Gaps:76/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 SGYHLRKADMLKNLEKIEKDAVVMEKKDICFCCSESYDTFHLGHINCPDCPKSFKTQTSYERHIF 310
            :|:.:.|.|.|.|              .||..|.|             |...:|....:|||   
  Fly    23 TGWQVEKHDPLSN--------------TICKSCLE-------------DAQNAFDIIETYER--- 57

  Fly   311 ITHSEFSDFPCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSN 375
             :| :|..|             |..:.||:.::.|..     |.::...:....:.......|.|
  Fly    58 -SH-QFYRF-------------LKDVREEESENDGSG-----CSEEVEAAERDLQDGADDVDSGN 102

  Fly   376 ETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTGEKP 440
            |.|...|.:                     :..:||.:.|..|...|...|.|.:|:|:||||:|
  Fly   103 EPDINECDI---------------------KAKEKPGFSCSHCPKSFQVKSNLKVHMRSHTGERP 146

  Fly   441 FDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHKCDECGKS 505
            |.|.||.|.|.....|:.|.|.||||:|:.|:.|.::|.....|..|::.|......:|..|.|.
  Fly   147 FTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKC 211

  Fly   506 FIQATQLRTHSKTHI--RPFPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALL 568
            |:.:..|:.|..||.  ..|.|.||.:.|:.|.:|..|::.|   :..:|:|..|.::|...|.|
  Fly   212 FLTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMRVH---QERLFTCGHCSKDFALHAYL 273

  Fly   569 KEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRT 617
            |.|:.......:..::|....:...:...|..|.|.|.....|..|:::
  Fly   274 KRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALSTHLKS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 5/20 (25%)
COG5048 <312..517 CDD:227381 53/204 (26%)
C2H2 Zn finger 321..341 CDD:275368 3/19 (16%)
zf-C2H2 348..368 CDD:278523 1/19 (5%)
C2H2 Zn finger 350..368 CDD:275368 1/17 (6%)
C2H2 Zn finger 382..402 CDD:275368 1/19 (5%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-H2C2_2 428..451 CDD:290200 13/22 (59%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
zf-H2C2_2 455..479 CDD:290200 10/23 (43%)
COG5048 <467..620 CDD:227381 39/153 (25%)
C2H2 Zn finger 471..491 CDD:275368 5/19 (26%)
zf-H2C2_2 484..508 CDD:290200 7/23 (30%)
C2H2 Zn finger 499..519 CDD:275368 6/19 (32%)
C2H2 Zn finger 525..545 CDD:275368 7/19 (37%)
C2H2 Zn finger 555..572 CDD:275368 6/16 (38%)
C2H2 Zn finger 598..615 CDD:275371 5/16 (31%)
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 16/71 (23%)
COG5048 <119..241 CDD:227381 44/121 (36%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-H2C2_2 133..158 CDD:290200 14/24 (58%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
zf-H2C2_2 162..185 CDD:290200 10/22 (45%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-C2H2_8 206..286 CDD:292531 24/82 (29%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
C2H2 Zn finger 260..297 CDD:275368 8/36 (22%)
C2H2 Zn finger 303..323 CDD:275368 6/20 (30%)
C2H2 Zn finger 353..373 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.