DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and CG17385

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:294 Identity:84/294 - (28%)
Similarity:133/294 - (45%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 NET--DTMSCKVCDRVFYRLDNLRSHLKQHLGTQVV---KKPEYMCHTCKNCFYSLSTLNIHIRT 434
            :||  :..|||.|||.|      ||...|.|..|.|   .|..|.|..|...|.:...|:.|::.
  Fly     9 DETVANQFSCKRCDRTF------RSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKV 67

  Fly   435 HTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHKC 499
            |...:||.|::|.|.|:..|.|::|...|:||:|::|..||::|..:..:.||...||||:|.:|
  Fly    68 HNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRC 132

  Fly   500 DECGKSFIQATQLRTHSKTHI--RPFPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNF 562
            ..||:.|.|...|:.|...|:  :|:.|..|::.|......:||:::|.:....|...|..:   
  Fly   133 QRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQ--- 194

  Fly   563 RTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRTVHE------- 620
            ...||.:|.::      .:|:.|.         .:|.:|...||:.....:|....||       
  Fly   195 AAAALARERLE------SEQKPSF---------FECMVCRAIFDTFADYEKHEAKCHEDHERAQL 244

  Fly   621 -------CDPDDIFGVEPHPSKRAKKDIESEEVV 647
                   ..|||..     |.|.|..|:::.|::
  Fly   245 EVNQMSHMHPDDYL-----PMKFAVPDLDTHEII 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 54/146 (37%)
C2H2 Zn finger 321..341 CDD:275368
zf-C2H2 348..368 CDD:278523
C2H2 Zn finger 350..368 CDD:275368
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-H2C2_2 428..451 CDD:290200 8/22 (36%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 9/23 (39%)
COG5048 <467..620 CDD:227381 39/154 (25%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
zf-H2C2_2 484..508 CDD:290200 11/23 (48%)
C2H2 Zn finger 499..519 CDD:275368 7/19 (37%)
C2H2 Zn finger 525..545 CDD:275368 5/19 (26%)
C2H2 Zn finger 555..572 CDD:275368 4/16 (25%)
C2H2 Zn finger 598..615 CDD:275371 4/16 (25%)
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 59/173 (34%)
C2H2 Zn finger 18..39 CDD:275368 11/26 (42%)
C2H2 Zn finger 48..68 CDD:275368 5/19 (26%)
C2H2 Zn finger 76..96 CDD:275368 7/19 (37%)
C2H2 Zn finger 104..124 CDD:275368 6/19 (32%)
C2H2 Zn finger 132..148 CDD:275368 6/15 (40%)
C2H2 Zn finger 160..180 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.