DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and Zfp524

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001102375.1 Gene:Zfp524 / 365179 RGDID:1565485 Length:314 Species:Rattus norvegicus


Alignment Length:416 Identity:81/416 - (19%)
Similarity:106/416 - (25%) Gaps:223/416 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 STAPAASTVKILNEK--------------KTPSATVTAVETTKIKTSPSKRKKMEHYVLQAVKSE 142
            |:.|..||:....||              :.|.|..|:..|.| .:.|.||.:....|       
  Rat     5 SSDPLPSTLSGEEEKPLALLPPVPRGRRGRPPGAATTSNRTLK-SSLPRKRGRPPRSV------- 61

  Fly   143 NTKADTTVTVVTEEDDTIDFILADDEEV---VPGRIENNNGQEIVVTEDDEDLGEDGDEDGEDSS 204
               .:|.:|...:...:.|.:|.||:.|   ||                     |....||...|
  Rat    62 ---QETPLTAAVDSSGSSDLLLIDDQGVPYTVP---------------------EGSAADGPQGS 102

  Fly   205 GKGNSSQTKIKEIVEHVCGKCYKTFRRVQSLKKHLEFCRYDSGYHLRKADMLKNLEKIEKDAVVM 269
            |.                             |:...|                            
  Rat   103 GS-----------------------------KRAPHF---------------------------- 110

  Fly   270 EKKDICFCCSESYDTFHLGHINCPDCPKSFKTQTSYERHIFITHSEFSDFPCSICNANLRSEALL 334
                                  ||.|.::|...:..||| .|:|||.                  
  Rat   111 ----------------------CPVCLRAFPYLSDLERH-SISHSEL------------------ 134

  Fly   335 ALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHL 399
                       ||:.||.|||.|.||.||:||               |.:               
  Rat   135 -----------KPHVCKDCGKTFKRSSHLRRH---------------CNI--------------- 158

  Fly   400 KQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHT 464
                                               |.|.:||.|.||.::|.....|..|.|.|:
  Rat   159 -----------------------------------HAGLRPFRCVLCPRRFREAGELAHHHRIHS 188

  Fly   465 GEKPYSCTVCNQAFAVKEVLNRHMKR 490
            ||:||.|..|...|.....|.||.||
  Rat   189 GERPYQCPSCRVRFTEANTLRRHYKR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 8/20 (40%)
COG5048 <312..517 CDD:227381 42/179 (23%)
C2H2 Zn finger 321..341 CDD:275368 0/19 (0%)
zf-C2H2 348..368 CDD:278523 12/19 (63%)
C2H2 Zn finger 350..368 CDD:275368 12/17 (71%)
C2H2 Zn finger 382..402 CDD:275368 1/19 (5%)
C2H2 Zn finger 415..435 CDD:275368 0/19 (0%)
zf-H2C2_2 428..451 CDD:290200 7/22 (32%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 10/23 (43%)
COG5048 <467..620 CDD:227381 10/24 (42%)
C2H2 Zn finger 471..491 CDD:275368 8/20 (40%)
zf-H2C2_2 484..508 CDD:290200 5/7 (71%)
C2H2 Zn finger 499..519 CDD:275368
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
Zfp524NP_001102375.1 COG5048 <102..218 CDD:227381 54/287 (19%)
C2H2 Zn finger 111..131 CDD:275368 8/20 (40%)
zf-H2C2_2 123..148 CDD:290200 15/54 (28%)
C2H2 Zn finger 139..159 CDD:275368 13/84 (15%)
zf-H2C2_2 151..174 CDD:290200 12/87 (14%)
C2H2 Zn finger 167..187 CDD:275368 7/19 (37%)
zf-H2C2_2 179..203 CDD:290200 10/23 (43%)
C2H2 Zn finger 195..216 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.