DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and CG17568

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:389 Identity:98/389 - (25%)
Similarity:150/389 - (38%) Gaps:69/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ETTKIKTSPSKRKKMEHYVLQAVKSENTKADTTVTVVTEEDDTIDFILADDEEVVPGRIENNNGQ 181
            ||:..:...|||....|.:       .||.:..:.:..:|     ||     ::.|..:|.|..|
  Fly   148 ETSSQEMEISKRTTTTHLI-------QTKKNVEMEIPKQE-----FI-----DLGPILLEKNTSQ 195

  Fly   182 EIVVTED--DEDLGEDGDEDGEDSSGKGNSSQTKIKEIVEHVCGKCYKTFRRVQSLKKHLEFCRY 244
              :..||  ||...|:..:...||:....|.:..:|                    .:.|:.|..
  Fly   196 --LDMEDVLDELPQEELSQPRLDSTTSPASMENDVK--------------------SEMLDSCEG 238

  Fly   245 DSGYHLRKADMLKNLEKIEKDAVVMEKKDICFCCSESYDTFHLGHINCPDCPKSFKTQTSYERHI 309
            |..: |.....|.:|..:......:|        |.:.:....|.::|..|.|.::.:.|||:|:
  Fly   239 DDDF-LPVDGQLMDLVAVATTPNTLE--------STAEEKAKRGRMDCEKCGKVYRNRASYEKHL 294

  Fly   310 --------FITHSEFSDFPCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRH 366
                    .....:.:...|.|||..|.|...|.||:|......|||.|..|||.......|..|
  Fly   295 ERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEH 359

  Fly   367 QKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIH 431
            :...:    |:....|.||...|..    |:.||.|.  |:..:|.::|:.|.....:..|.|:|
  Fly   360 KLVHT----ESRPFECTVCKAGFKN----RARLKAHY--QIHAEPSFVCNICGKKLQTRRTWNMH 414

  Fly   432 IRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRH-MKRHTGE 494
            ...||.|:...||:|...|.....||.|...|||.:||.|..|.::||.......| :|:|..|
  Fly   415 KVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKHPQE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 7/28 (25%)
COG5048 <312..517 CDD:227381 58/184 (32%)
C2H2 Zn finger 321..341 CDD:275368 10/19 (53%)
zf-C2H2 348..368 CDD:278523 7/19 (37%)
C2H2 Zn finger 350..368 CDD:275368 6/17 (35%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-H2C2_2 428..451 CDD:290200 8/22 (36%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 10/23 (43%)
COG5048 <467..620 CDD:227381 10/29 (34%)
C2H2 Zn finger 471..491 CDD:275368 6/20 (30%)
zf-H2C2_2 484..508 CDD:290200 4/12 (33%)
C2H2 Zn finger 499..519 CDD:275368
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 54/167 (32%)
C2H2 Zn finger 314..335 CDD:275368 10/20 (50%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 9/25 (36%)
C2H2 Zn finger 398..418 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 439..463 CDD:290200 11/23 (48%)
C2H2 Zn finger 454..475 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.