DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and ZNF707

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001094068.1 Gene:ZNF707 / 286075 HGNCID:27815 Length:371 Species:Homo sapiens


Alignment Length:289 Identity:86/289 - (29%)
Similarity:128/289 - (44%) Gaps:35/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 HEEQHKSRGKPYACKICGKDFTRSYHLKRHQ-KYSSCSSNETD----TMSCKVCDRVFYRLDNLR 396
            |::.|..|.:...    |..|.:.:.|.... :....:...||    ...|:|..:...|....|
Human   104 HKKTHVRRERARE----GSSFRKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRR 164

  Fly   397 SHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRR 461
            ...||.     ..:..::|.||.......|.|..|...|||.|.|:|..|.:.|.....|::|::
Human   165 ERRKQR-----AVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQK 224

  Fly   462 YHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTHI--RPFP 524
            .||.|||:.|..|.|||::|:.|.:|.|.||..||:.|.:|||:|.|.:.|..|...|.  |||.
Human   225 NHTREKPFCCEACGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFY 289

  Fly   525 CEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSA 589
            |..|.:.|:|::.|..|.:.||..|  .::||||.::||.|                :..|:...
Human   290 CADCGKAFRTKENLSHHQRVHSGEK--PYTCAECGKSFRWP----------------KGFSIHRR 336

  Fly   590 VKIMER-TDCAICDKNFDSSDTLRRHIRT 617
            :.:.:| .:|..|.|.|.......||.||
Human   337 LHLTKRFYECGHCGKGFRHLGFFTRHQRT 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 56/184 (30%)
C2H2 Zn finger 321..341 CDD:275368 1/3 (33%)
zf-C2H2 348..368 CDD:278523 3/20 (15%)
C2H2 Zn finger 350..368 CDD:275368 3/18 (17%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..451 CDD:290200 9/22 (41%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..479 CDD:290200 11/23 (48%)
COG5048 <467..620 CDD:227381 53/154 (34%)
C2H2 Zn finger 471..491 CDD:275368 9/19 (47%)
zf-H2C2_2 484..508 CDD:290200 12/23 (52%)
C2H2 Zn finger 499..519 CDD:275368 8/19 (42%)
C2H2 Zn finger 525..545 CDD:275368 6/19 (32%)
C2H2 Zn finger 555..572 CDD:275368 7/16 (44%)
C2H2 Zn finger 598..615 CDD:275371 5/16 (31%)
ZNF707NP_001094068.1 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..143 7/42 (17%)
C2H2 Zn finger 178..198 CDD:275368 6/19 (32%)
COG5048 <187..366 CDD:227381 69/197 (35%)
C2H2 Zn finger 206..226 CDD:275368 5/19 (26%)
zf-H2C2_2 218..242 CDD:290200 11/23 (48%)
C2H2 Zn finger 234..254 CDD:275368 9/19 (47%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
zf-H2C2_2 274..299 CDD:290200 9/24 (38%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
zf-H2C2_2 302..325 CDD:290200 9/24 (38%)
C2H2 Zn finger 318..338 CDD:275368 8/35 (23%)
C2H2 Zn finger 346..366 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.