DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and ZNF740

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:XP_006719407.1 Gene:ZNF740 / 283337 HGNCID:27465 Length:207 Species:Homo sapiens


Alignment Length:123 Identity:45/123 - (36%)
Similarity:62/123 - (50%) Gaps:25/123 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 HQKYSSCSSNETDTMSCKVCDRVFYRLDNL--RSHLKQHL---------GTQVVKKPE-YMCHTC 418
            |:|.|..|.:..|.             |:|  .||.|:.:         |:..||.|: ::|..|
Human    55 HRKDSDKSRSRKDD-------------DSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHC 106

  Fly   419 KNCFYSLSTLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQ 476
            ...|.|...|..||..|||||||:||:||.:|.....|::|:|.|:|||||.|..|:|
Human   107 FGAFRSSYHLKRHILIHTGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 45/123 (37%)
C2H2 Zn finger 321..341 CDD:275368
zf-C2H2 348..368 CDD:278523 1/1 (100%)
C2H2 Zn finger 350..368 CDD:275368 1/1 (100%)
C2H2 Zn finger 382..402 CDD:275368 5/21 (24%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-H2C2_2 428..451 CDD:290200 14/22 (64%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
zf-H2C2_2 455..479 CDD:290200 12/22 (55%)
COG5048 <467..620 CDD:227381 6/10 (60%)
C2H2 Zn finger 471..491 CDD:275368 3/6 (50%)
zf-H2C2_2 484..508 CDD:290200
C2H2 Zn finger 499..519 CDD:275368
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
ZNF740XP_006719407.1 COG5048 96..>178 CDD:227381 33/69 (48%)
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
zf-H2C2_2 115..140 CDD:290200 15/24 (63%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
zf-H2C2_2 143..>163 CDD:290200 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.