DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and Y111B2A.10

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_499640.1 Gene:Y111B2A.10 / 176678 WormBaseID:WBGene00013734 Length:430 Species:Caenorhabditis elegans


Alignment Length:474 Identity:107/474 - (22%)
Similarity:176/474 - (37%) Gaps:131/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TPKTEKRGATKSTAPAASTVKILNEKKTPSATVTAVE--TTKIKTSPSKRKKMEHYVLQAVKSEN 143
            ||.|....::.|.|.|       |...|.:..|...:  ..:::..|..|:..|  |.:.|:||:
 Worm    14 TPVTSCSSSSNSEADA-------NNFSTKNKNVNEFQKLIEELEFEPEDRRVPE--VAEEVESED 69

  Fly   144 TKADTTVTVVTEEDDTIDFIL--ADDEEVVPGRIENNNGQEIVVTEDDEDLGEDGDEDGEDSSGK 206
            .:         |||..|.:..  .|..:.:..|||..             |.:.|||..|..:.:
 Worm    70 EE---------EEDVQIKYPYERKDAYQDLQERIERR-------------LNDSGDEKLEQKAKE 112

  Fly   207 GNS------SQTKIKE--------IVEHVCGK------CYKTFRRVQSLKKHLEFCRYDSGYHLR 251
            ..|      ||.|:::        :..|..|.      |.|.|...::|:.|             
 Worm   113 LQSLIRMSQSQWKVEQKQQLEDSLLKPHTAGSIFTCVMCSKAFPNAEALQIH------------- 164

  Fly   252 KADMLKNLEKIEKDAVVMEKKDICFCCSESYD---------TFHLGHINCPDCPKSFKTQTSYER 307
             .|.:.:|.::         |..|..|.::|.         ..||..|.|.:|...|:::.|.:.
 Worm   165 -TDQVHDLSRL---------KHRCKLCGKAYKRKKNLDAHMALHLKEIQCDNCSLVFQSEKSLQS 219

  Fly   308 HIFITHSEFSD------FPCSICNANLRSEALLALHEEQHKSRGK-------PYACKICGKDFTR 359
            ||...|.|.:|      .|||||. .|.....:..||...|:|.|       ....|:.....:.
 Worm   220 HIIRHHQEDADELEVWKAPCSICK-ELFPSTSVKTHEWYCKNREKIIEKQRVSKILKVQSLPSSP 283

  Fly   360 SYHLKRHQKYSSCSSNETDT------MSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTC 418
            :.....:..:|||......:      .||:||...|..    |..:.:|:|.   |.|:     .
 Worm   284 ALSTVSYASFSSCQPGPITSPVSYRDKSCQVCGESFAS----RQSMLRHVGR---KHPD-----A 336

  Fly   419 KNCFYSLSTLNI----HIRTHTGEKPFDCDLCDKKFSALVALKKHR-RYHTGEKPYSCTVCNQAF 478
            ||      ..|:    :|...:.:.|:.|..|.|:|:.:.||..|: |.|:....:.||:|::::
 Worm   337 KN------DPNVTAVRYISAESPKHPYACIECGKRFTTVTALSTHKARVHSQSNRFECTICHKSY 395

  Fly   479 AVKEVLNRHMKR-HTGERP 496
            .|...|.:|:|| |..:.|
 Worm   396 PVPSELRKHIKRVHEKDAP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368 6/20 (30%)
COG5048 <312..517 CDD:227381 52/210 (25%)
C2H2 Zn finger 321..341 CDD:275368 7/19 (37%)
zf-C2H2 348..368 CDD:278523 1/19 (5%)
C2H2 Zn finger 350..368 CDD:275368 1/17 (6%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
C2H2 Zn finger 415..435 CDD:275368 4/23 (17%)
zf-H2C2_2 428..451 CDD:290200 6/26 (23%)
C2H2 Zn finger 443..463 CDD:275368 8/20 (40%)
zf-H2C2_2 455..479 CDD:290200 8/24 (33%)
COG5048 <467..620 CDD:227381 10/31 (32%)
C2H2 Zn finger 471..491 CDD:275368 8/20 (40%)
zf-H2C2_2 484..508 CDD:290200 6/14 (43%)
C2H2 Zn finger 499..519 CDD:275368
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
Y111B2A.10NP_499640.1 C2H2 Zn finger 148..169 CDD:275368 6/34 (18%)
zf-C2H2_8 151..221 CDD:292531 18/92 (20%)
C2H2 Zn finger 178..198 CDD:275368 3/19 (16%)
C2H2 Zn finger 204..224 CDD:275368 6/19 (32%)
C2H2 Zn finger 312..333 CDD:275368 7/27 (26%)
C2H2 Zn finger 359..380 CDD:275368 8/20 (40%)
C2H2 Zn finger 388..409 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.