DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and ZNF579

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:XP_016881898.1 Gene:ZNF579 / 163033 HGNCID:26646 Length:640 Species:Homo sapiens


Alignment Length:446 Identity:95/446 - (21%)
Similarity:129/446 - (28%) Gaps:177/446 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKV 384
            ||..|....|....|:.|...| |..:|:||.:|.|.|.|..||.||.:    .......:.|..
Human    45 PCPTCGRLFRFPYYLSRHRLSH-SGLRPHACPLCPKAFRRPAHLSRHLR----GHGPQPPLRCAA 104

  Fly   385 CDRVFYRLDNLRSHLKQ-HLGTQV------VKK-------------------------------- 410
            |.|.|.....||.||.| |.|.:|      |.|                                
Human   105 CPRTFPEPAQLRRHLAQEHAGGEVELAIERVAKETAEPSWGPQDEGSEPPTTAAAGATEEEAVAA 169

  Fly   411 -PE---------------------------------------------------------YMCHT 417
             ||                                                         .:|..
Human   170 WPETWPAGEPSTLAAPTSAAEPRESESEEAEAGAAELRAELALAAGRQEEKQVLLQADWTLLCLR 234

  Fly   418 CKNCFYSLSTLNIH--IR---THTGE-------KPFDCDLCDKKFSALVALKKHRRYHTGEKPYS 470
            |:..|.:...|..|  :|   ...||       |...|.:|.|.|:...:|.:||..|:.::|:.
Human   235 CREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQCSICLKAFARPWSLSRHRLVHSTDRPFV 299

  Fly   471 CTVCNQAFAVKEVLNRHMKRH-------------------------------------------- 491
            |..|..||.:...|.:|.:.|                                            
Human   300 CPDCGLAFRLASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECGGASEGG 364

  Fly   492 --------------TGERPHKCDECGKSFIQATQLRTHSKTH--IRPFPCEQCDEKFKTEKQLER 540
                          .||....|.||||.|.:...||.|..||  .|||.|.:|..:||....|.|
Human   365 EGQNGGDAAPARPPAGEPRFWCPECGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLAR 429

  Fly   541 HVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERT 596
            |.:.|:....| ..|..|.|.|.....|..|  :..|..:.:|::...|::....|
Human   430 HAQVHAGGPAP-HPCPRCPRRFSRAYSLLRH--QRCHRAELERAAALQALQAQAPT 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 71/363 (20%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
zf-C2H2 348..368 CDD:278523 10/19 (53%)
C2H2 Zn finger 350..368 CDD:275368 9/17 (53%)
C2H2 Zn finger 382..402 CDD:275368 9/20 (45%)
C2H2 Zn finger 415..435 CDD:275368 6/24 (25%)
zf-H2C2_2 428..451 CDD:290200 9/34 (26%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 8/23 (35%)
COG5048 <467..620 CDD:227381 43/190 (23%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
zf-H2C2_2 484..508 CDD:290200 11/81 (14%)
C2H2 Zn finger 499..519 CDD:275368 9/19 (47%)
C2H2 Zn finger 525..545 CDD:275368 7/19 (37%)
C2H2 Zn finger 555..572 CDD:275368 5/16 (31%)
C2H2 Zn finger 598..615 CDD:275371
ZNF579XP_016881898.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.