| Sequence 1: | NP_001247098.1 | Gene: | su(Hw) / 41740 | FlyBaseID: | FBgn0003567 | Length: | 941 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011524789.1 | Gene: | ZNF524 / 147807 | HGNCID: | 28322 | Length: | 370 | Species: | Homo sapiens |
| Alignment Length: | 209 | Identity: | 57/209 - (27%) |
|---|---|---|---|
| Similarity: | 80/209 - (38%) | Gaps: | 69/209 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 468 PYSCTVCNQAFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTH--IRPFPCEQCDE 530
Fly 531 KFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMER 595
Fly 596 TDCAICDKNFDSSDTLRRHIRTVHE-------CDPDDIFGVEPHPSKRAKKDIESEEVVPVALNT 653
Fly 654 SAGSLISSQTDGNG 667 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| su(Hw) | NP_001247098.1 | C2H2 Zn finger | 292..313 | CDD:275368 | |
| COG5048 | <312..517 | CDD:227381 | 20/48 (42%) | ||
| C2H2 Zn finger | 321..341 | CDD:275368 | |||
| zf-C2H2 | 348..368 | CDD:278523 | |||
| C2H2 Zn finger | 350..368 | CDD:275368 | |||
| C2H2 Zn finger | 382..402 | CDD:275368 | |||
| C2H2 Zn finger | 415..435 | CDD:275368 | |||
| zf-H2C2_2 | 428..451 | CDD:290200 | |||
| C2H2 Zn finger | 443..463 | CDD:275368 | |||
| zf-H2C2_2 | 455..479 | CDD:290200 | 5/10 (50%) | ||
| COG5048 | <467..620 | CDD:227381 | 42/153 (27%) | ||
| C2H2 Zn finger | 471..491 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 484..508 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 499..519 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 525..545 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 555..572 | CDD:275368 | 0/16 (0%) | ||
| C2H2 Zn finger | 598..615 | CDD:275371 | 8/16 (50%) | ||
| ZNF524 | XP_011524789.1 | COG5048 | <219..>283 | CDD:227381 | 26/63 (41%) |
| C2H2 Zn finger | 222..242 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 234..259 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 262..285 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 290..314 | CDD:290200 | 9/68 (13%) | ||
| C2H2 Zn finger | 306..327 | CDD:275368 | 9/20 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||