DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and si:dkeyp-2e4.6

DIOPT Version :9

Sequence 1:NP_001247098.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001124126.1 Gene:si:dkeyp-2e4.6 / 100002333 ZFINID:ZDB-GENE-061009-50 Length:271 Species:Danio rerio


Alignment Length:175 Identity:60/175 - (34%)
Similarity:91/175 - (52%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 GKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVK 409
            ||.:.||:||.:||.:.::.||.:..:    |.....|::|.:.|.|.|.|:.|:..|.|.:..:
Zfish    99 GKKFVCKLCGFEFTYNSNMVRHMRIHT----EETPYVCEICGKGFKRQDWLKLHISVHTGVKRKR 159

  Fly   410 KPEYMCHTCKNCFYSLSTLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVC 474
            |..:.|..|...|:..:.|..|:..|.||:||.|..|||.|.:...|.:|......:|.:||::|
Zfish   160 KKTFGCDQCGKKFHGSTALQSHLNKHRGERPFPCVQCDKSFFSHSDLYRHINDCHSQKKHSCSLC 224

  Fly   475 NQAFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTH 519
            ...|..:..|.:||:.||||||:.|..|||:|........|.|.|
Zfish   225 GNGFTRRTSLLKHMRIHTGERPYSCPHCGKTFPYKYSFEMHLKRH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(Hw)NP_001247098.1 C2H2 Zn finger 292..313 CDD:275368
COG5048 <312..517 CDD:227381 58/171 (34%)
C2H2 Zn finger 321..341 CDD:275368
zf-C2H2 348..368 CDD:278523 8/19 (42%)
C2H2 Zn finger 350..368 CDD:275368 8/17 (47%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-H2C2_2 428..451 CDD:290200 11/22 (50%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..479 CDD:290200 6/23 (26%)
COG5048 <467..620 CDD:227381 22/53 (42%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
zf-H2C2_2 484..508 CDD:290200 14/23 (61%)
C2H2 Zn finger 499..519 CDD:275368 7/19 (37%)
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 555..572 CDD:275368
C2H2 Zn finger 598..615 CDD:275371
si:dkeyp-2e4.6NP_001124126.1 COG5048 <98..256 CDD:227381 56/160 (35%)
C2H2 Zn finger 104..124 CDD:275368 8/19 (42%)
zf-H2C2_2 116..141 CDD:290200 6/28 (21%)
C2H2 Zn finger 132..152 CDD:275368 7/19 (37%)
C2H2 Zn finger 165..185 CDD:275368 5/19 (26%)
zf-H2C2_2 177..200 CDD:290200 11/22 (50%)
C2H2 Zn finger 193..241 CDD:275368 15/47 (32%)
zf-H2C2_2 233..256 CDD:290200 13/22 (59%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.