DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment red and lysmd2

DIOPT Version :10

Sequence 1:NP_650352.1 Gene:red / 41738 FlyBaseID:FBgn0285913 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001003507.1 Gene:lysmd2 / 445113 ZFINID:ZDB-GENE-040801-250 Length:208 Species:Danio rerio


Alignment Length:141 Identity:51/141 - (36%)
Similarity:73/141 - (51%) Gaps:22/141 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SQFQEIVPDMDD-------SEFMFNEKQSIRDS--------GRTLKR-YGSTCCNSLRNNETLIR 63
            ::|..::|.:.|       .:.:|...:|..:|        .||..| ||||...:....|..|.
Zfish     2 AEFSPVLPPLRDDGGGGRYGQPLFPRSRSGSESDSELSQSLARTKTRSYGSTASVTAPLGEKYIE 66

  Fly    64 HIVEKTDTLQGIALKYGCTTEQIRRANRLFASDSLFLRQFLLVPV--EKNSPYYPQVPGDSIAAF 126
            |.|...:||||||||||.|.|||:|.|:||::|.:|||..|.:||  ||.|.:    .|.|:.:.
Zfish    67 HRVTDGETLQGIALKYGVTMEQIKRVNKLFSNDCIFLRNTLSIPVKSEKRSLF----NGLSLESP 127

  Fly   127 DAVLATPPGTP 137
            |:...||..:|
Zfish   128 DSEGNTPQESP 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
redNP_650352.1 LysM <62..108 CDD:440998 26/45 (58%)
lysmd2NP_001003507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 12/51 (24%)
LysM 65..109 CDD:212030 26/43 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..169 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..208
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.