DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment red and CG15471

DIOPT Version :10

Sequence 1:NP_650352.1 Gene:red / 41738 FlyBaseID:FBgn0285913 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_572187.2 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster


Alignment Length:68 Identity:25/68 - (36%)
Similarity:37/68 - (54%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSTCCNSLR-NNETLIRHIVEKTDTLQGIALKYGCTTEQIRRANRLFASDSLFLRQFLLVPVEKN 111
            |...||..| .:|...||.:...||:..:||||..:..:|.||||:.:.|.|..|:.:.||: .|
  Fly     9 GPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPI-PN 72

  Fly   112 SPY 114
            |.:
  Fly    73 SQF 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
redNP_650352.1 LysM <62..108 CDD:440998 17/45 (38%)
CG15471NP_572187.2 LysM 26..69 CDD:396179 15/42 (36%)

Return to query results.
Submit another query.