DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trx and PHF6

DIOPT Version :10

Sequence 1:NP_476769.1 Gene:trx / 41737 FlyBaseID:FBgn0003862 Length:3726 Species:Drosophila melanogaster
Sequence 2:NP_115834.1 Gene:PHF6 / 84295 HGNCID:18145 Length:365 Species:Homo sapiens


Alignment Length:164 Identity:45/164 - (27%)
Similarity:77/164 - (46%) Gaps:17/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1735 RMCLFCRKSGEGLSGE----EARLLYCGHDCWVHTNCAMWSAEVFEEIDG-SLQNVHSAVARGRM 1794
            |.|.||:.:.:...|:    |.:.:...|.|.:.::..:.|....|.:.| |:::|...:.||..
Human    15 RKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTK 79

  Fly  1795 IKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDK------SMYCPAHAKNGNALKANGS 1853
            :.|::|...|||:||:|::|...|||.||.. |.|.:.:|      .:||..|.|..:..:|:..
Human    80 LMCSLCHCPGATIGCDVKTCHRTYHYHCALH-DKAQIREKPSQGIYMVYCRKHKKTAHNSEADLE 143

  Fly  1854 PSVTYESNFEVSRPVYVELDRKRKKLIEPARVQF 1887
            .|.. |...|.|.|    ..:|:.:...|.:..|
Human   144 ESFN-EHELEPSSP----KSKKKSRKGRPRKTNF 172

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
trxNP_476769.1 NR_DBD_like 762..>856 CDD:413390
PRK13914 <1006..>1224 CDD:237555
PHD1_KMT2A_like 1268..1344 CDD:276981
PHD 1346..1390 CDD:214584
PHD3_KMT2A_like 1423..1479 CDD:276983
ePHD_KMT2A_like 1737..1841 CDD:277134 33/114 (29%)
FYRN 1890..1937 CDD:461787
FYRC 3388..3476 CDD:197781
SET_KMT2A_2B 3575..3726 CDD:380947