DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trx and CG4565

DIOPT Version :9

Sequence 1:NP_476769.1 Gene:trx / 41737 FlyBaseID:FBgn0003862 Length:3726 Species:Drosophila melanogaster
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:180 Identity:55/180 - (30%)
Similarity:88/180 - (48%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  3567 RGTGSNLPMAMKYRTLKETYKDYVGVFRSHIHG-RGLYCTKDIEAGEMVIEYAGELIRSTLTDKR 3630
            |.|.||       |.:....:.::.:|.|.::| :||..|..|..|..:.||||||:  |:.:.|
  Fly    97 RNTCSN-------RLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELL--TVPEAR 152

  Fly  3631 ERYYDSRGIGC--YMFKIDDN--------LVVDATMRGNAARFINHCCEPNCYSKVVDI------ 3679
            .|.:|:..:|.  |:..:::.        .:||.:.|||..|::||.|||||:...|.|      
  Fly   153 SRLHDNEKLGLMNYILVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPK 217

  Fly  3680 LGHKHIIIFALRRIVQGEELTYDYKFPFEDEKI----PCSCGSKRCRKYL 3725
            :|     |||.|.|...|||.:.|....:.:|:    .|.||:.:|..::
  Fly   218 IG-----IFAARDIAAKEELCFHYGGEGQYKKMTGGKTCLCGASKCTGFM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trxNP_476769.1 NR_DBD_like 762..>856 CDD:295381
PHD1_KMT2A_like 1268..1344 CDD:276981
PHD 1346..1390 CDD:214584
PHD3_KMT2A_like 1423..1479 CDD:276983
ePHD_KMT2A_like 1737..1841 CDD:277134
FYRN 1891..1935 CDD:283589
FYRC 3388..3476 CDD:197781
SET 3590..3710 CDD:214614 45/136 (33%)
CG4565NP_001097743.1 Pre-SET 10..103 CDD:282838 4/12 (33%)
SET 111..239 CDD:214614 45/134 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.