DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14839 and CG34459

DIOPT Version :9

Sequence 1:NP_650351.2 Gene:CG14839 / 41736 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster


Alignment Length:299 Identity:106/299 - (35%)
Similarity:150/299 - (50%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRIDTQIMWLIIVLSSLPASATGNHYRTRRKPM---QTEDSDLMRSFA----------------- 45
            |||...:...::.|..|....||:....|..|.   ..:..:|:..||                 
  Fly     1 MRIRGVLAMYLMFLRLLLHCTTGHTLPQRHSPQHKRMIDPRELLNDFAAIKEPGTSEVAPKNSAR 65

  Fly    46 --------GGLGGGG----PGDGTVCDMSGEDSN---SPAKKTRNHT-----NAKQRSSGIAVQA 90
                    |.:.|.|    ||.||  |.|...||   .|..|....|     :.||:||.||::|
  Fly    66 SIALYNAGGAMSGSGEGTAPGPGT--DNSKSASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKA 128

  Fly    91 ANEAKKANDDMKNAVKEAADKIKGEYADKANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEE 155
            |.:||.|::....|.:.||..||.|.|:||..:||||||.|.||..:::|||.||:||..||:||
  Fly   129 AQDAKAASEAQSAAGQAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEE 193

  Fly   156 NQELITAESNAQLAAKTHQLVQQELKTLTISLKLAKDIKDASDQVYTV---WQQSLADKTALLEA 217
            :..:...|:|...|.:..::..|:.:|:.   :|.|..:::...:.||   .||.:|.||.||||
  Fly   194 SNSIHHTEANMNAAVEAVKVAVQQFETIN---ELQKTARESLTNIQTVAMGSQQEMAAKTQLLEA 255

  Fly   218 AQRRVNVLMRQLSEARLDYDKTKKAALSAAKAAQEAKQR 256
            |:.|:.:|.:||..|..||:|||:||..||.||.|||||
  Fly   256 ARNRMAMLQKQLVSAHDDYEKTKQAAYKAACAAVEAKQR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 66/167 (40%)
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 80/183 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.