DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14839 and CG11694

DIOPT Version :9

Sequence 1:NP_650351.2 Gene:CG14839 / 41736 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster


Alignment Length:233 Identity:99/233 - (42%)
Similarity:136/233 - (58%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GPGDGTVCDMSGEDSNSPAK-KTRNHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGE 115
            |.||.:|...||   .:|.. |....|..|  :|.||.:||.||.:|:|....|.:.||.::|.:
  Fly    39 GDGDNSVSSSSG---GAPCDFKMNGKTRVK--ASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQ 98

  Fly   116 YADKANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQEL 180
            .||||.||||||||.|.||.|::||||:||||.|:|||||:..|.|.::....|.:..:....:|
  Fly    99 LADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQL 163

  Fly   181 KTLTISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALS 245
            .|:|:::|.|:|....|:.|.:..||.|.:|..|:|||::||.:|:|||..||:|:..||.||..
  Fly   164 NTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEK 228

  Fly   246 AAKAAQEAKQRIDQSECEGGSRGRRGRRA------WLE 277
            ||.|||||:.|..          |..|||      ||:
  Fly   229 AACAAQEARHRAT----------RERRRAELRHLLWLK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 73/159 (46%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 22/60 (37%)
DUF745 60..223 CDD:283087 73/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.