DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14841 and CG34459

DIOPT Version :9

Sequence 1:NP_650350.1 Gene:CG14841 / 41735 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster


Alignment Length:221 Identity:108/221 - (48%)
Similarity:141/221 - (63%) Gaps:17/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ASGGSSEGCETSSAVQNSCGLSQK-----------------NAKSKASSIAIKAAQDAKAANDAQ 104
            |..||.||........||...|.|                 :.|.|:|.||:|||||||||::||
  Fly    75 AMSGSGEGTAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQ 139

  Fly   105 MAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIMEQLELEEKEAVAVVDEVKNSLHSTQVNA 169
            .|||:||:..:|.:|||||.|:|:||||||.|||.:::|||.|.:||.|||:|..||:|.|:.|.
  Fly   140 SAAGQAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEANM 204

  Fly   170 ESAMLAFSEAKIQLDQLKVLLAEATAQMTNIETFANGAQLEMDEKGQLLEAANRRVESISRQVVA 234
            .:|:.|...|..|.:.:..|...|...:|||:|.|.|:|.||..|.||||||..|:..:.:|:|:
  Fly   205 NAAVEAVKVAVQQFETINELQKTARESLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVS 269

  Fly   235 ARQDYDKTKKAAYKAACAAVEAKQKA 260
            |..||:|||:||||||||||||||:|
  Fly   270 AHDDYEKTKQAAYKAACAAVEAKQRA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14841NP_650350.1 DUF745 81..260 CDD:283087 98/178 (55%)
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 98/179 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.