DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14841 and CG14839

DIOPT Version :9

Sequence 1:NP_650350.1 Gene:CG14841 / 41735 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650351.2 Gene:CG14839 / 41736 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster


Alignment Length:258 Identity:95/258 - (36%)
Similarity:133/258 - (51%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IIMISDSDPVVA--RLYEPASEKKQT-------------ASGGSSEG--CETSSAVQNSCGLSQK 80
            :|::..|.|..|  ..|....:..||             ..||..:|  |:.|....||.....:
  Fly    10 LIIVLSSLPASATGNHYRTRRKPMQTEDSDLMRSFAGGLGGGGPGDGTVCDMSGEDSNSPAKKTR 74

  Fly    81 ---NAKSKASSIAIKAAQDAKAANDAQMAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIME 142
               |||.::|.||::||.:||.|||....|.:.|:.::|.:.|:||..||:||||.|.||.|::|
  Fly    75 NHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAAAKAAEAVLFGKSQVLE 139

  Fly   143 QLELEEKEAVAVVDEVKNSLHSTQVNAESA----MLAFSEAKIQLDQLKVL--LAEATAQMTNIE 201
            |||.|.:||..||.|....|.:.:.||:.|    .|...|.|.....||:.  :.:|:.|:..: 
  Fly   140 QLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQELKTLTISLKLAKDIKDASDQVYTV- 203

  Fly   202 TFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAACAAVEAKQKAQRMQ 264
                 .|..:.:|..|||||.|||..:.||:..||.|||||||||..||.||.||||:..:.:
  Fly   204 -----WQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAKAAQEAKQRIDQSE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14841NP_650350.1 DUF745 81..260 CDD:283087 81/184 (44%)
CG14839NP_650351.2 DUF745 77..237 CDD:283087 65/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.