DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14840 and CG34459

DIOPT Version :9

Sequence 1:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster


Alignment Length:235 Identity:124/235 - (52%)
Similarity:155/235 - (65%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ALYGDASIDGTGGA-GGLG-GGSEGCGEPNSKKG--------VGCSSGTGVFGRGDPKQKASNIA 92
            |||      ..||| .|.| |.:.|.|..|||..        ..|:..| :...||||||:|.||
  Fly    68 ALY------NAGGAMSGSGEGTAPGPGTDNSKSASNKQCDPQAKCNVKT-IITPGDPKQKSSMIA 125

  Fly    93 QKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEAALAGKQQIVEQLQQEMTEADAVV 157
            .||||:|||||::|.||.:|||..:|.|||.||.|||:||||||.|||.:|:||:||:.||.|||
  Fly   126 MKAAQDAKAASEAQSAAGQAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVV 190

  Fly   158 TEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNLANIENVASGAQQELAEKTQLLEA 222
            .|.::|:.:|:||.|||..|...|..|...:..|...|..:|.||:.||.|:|||:|.|||||||
  Fly   191 EEESNSIHHTEANMNAAVEAVKVAVQQFETINELQKTARESLTNIQTVAMGSQQEMAAKTQLLEA 255

  Fly   223 AKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQKA 262
            |::|:..|.:|:..|..|:|||||||||||||||||||:|
  Fly   256 ARNRMAMLQKQLVSAHDDYEKTKQAAYKAACAAVEAKQRA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14840NP_650349.1 DUF745 82..262 CDD:283087 107/179 (60%)
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 107/179 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.