DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14840 and CG14354

DIOPT Version :9

Sequence 1:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 / 43120 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster


Alignment Length:187 Identity:105/187 - (56%)
Similarity:134/187 - (71%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RGDPKQKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEAALAGKQQIVEQ 145
            :|:.||.|||||||||||||.|||:|..||.|||.|||::||.||..:|:|||||||||||::||
  Fly    58 QGNSKQTASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLAEKAIAAAKAAEAALAGKQQLMEQ 122

  Fly   146 LQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNLANIENVASGAQ 210
            ||.|:.||:.:|.|.|.||..:|.|.|.|.:.|.:.|:.|..|::.|..|...::|.|..|||||
  Fly   123 LQDEVHEAEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQ 187

  Fly   211 QELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQKAQRSRR 267
            |||.||.||:|.|:.|.|.|.:|:..||.|:..|::|||:|||||.||:.||.|.||
  Fly   188 QELCEKNQLVETARQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANEARNKAVRDRR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14840NP_650349.1 DUF745 82..262 CDD:283087 100/179 (56%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 100/179 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.