DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14840 and CG14841

DIOPT Version :9

Sequence 1:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650350.1 Gene:CG14841 / 41735 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster


Alignment Length:274 Identity:139/274 - (50%)
Similarity:175/274 - (63%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KALLLVLLLLRAFPR-----------LESYHYRPAETNDKQCLSALYGDASIDGTGGAGGLGGGS 58
            :|:.|.||.|....|           :.:..|.|| :..||..|                 ||.|
  Fly    16 QAMCLFLLSLACVSRSHIIMISDSDPVVARLYEPA-SEKKQTAS-----------------GGSS 62

  Fly    59 EGCGEPNSKKGVGCSSGTGVFGRGDPKQKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAA 123
            ||| |.:|.....|.     ..:.:.|.|||:||.||||:||||:|:||||.|||:.|||.:||.
  Fly    63 EGC-ETSSAVQNSCG-----LSQKNAKSKASSIAIKAAQDAKAANDAQMAAGEAASLQVKQDLAE 121

  Fly   124 KAAQSARAAEAALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQL 188
            ||.|:||||||||||||||:|||:.|..||.|||.||.:||.:||.||.:|..|..||:.||:||
  Fly   122 KAVQAARAAEAALAGKQQIMEQLELEEKEAVAVVDEVKNSLHSTQVNAESAMLAFSEAKIQLDQL 186

  Fly   189 KNLVIAATSNLANIENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAAC 253
            |.|:..||:.:.|||..|:|||.|:.||.||||||..|||:::||:..|:.|::|||:|||||||
  Fly   187 KVLLAEATAQMTNIETFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAAC 251

  Fly   254 AAVEAKQKAQRSRR 267
            |||||||||||.:|
  Fly   252 AAVEAKQKAQRMQR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14840NP_650349.1 DUF745 82..262 CDD:283087 113/179 (63%)
CG14841NP_650350.1 DUF745 81..260 CDD:283087 113/178 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.