DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS-m and YARS1

DIOPT Version :9

Sequence 1:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_003671.1 Gene:YARS1 / 8565 HGNCID:12840 Length:528 Species:Homo sapiens


Alignment Length:537 Identity:110/537 - (20%)
Similarity:188/537 - (35%) Gaps:168/537 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRIKCLRYLGTRYNSSHYVT--TPIFYVNAAPHIGHLYSAVIADAHCRYQRLRYPEQDVRLCTGT 66
            |.:|.  |.||......:|.  .|:..:......|...:.:.||.|.....::.|.:.:.|....
Human    34 RELKI--YWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSY 96

  Fly    67 DEHGTKIQQAASLH--GVPVAK--------YCDDISQRYR-EVFRSASIQQDDFIRTTEDRHKRA 120
            .|:..|    |.|.  |||:.|        |  .:|:.|. :|:|.:|:       .|:...|:|
Human    97 YENVIK----AMLESIGVPLEKLKFIKGTDY--QLSKEYTLDVYRLSSV-------VTQHDSKKA 148

  Fly   121 VANFWRTLHTRGH--IYSAAYSGWYCVSDETFLTDSQL-RLDE------------ATGTRYSLE- 169
            .|...:.:.   |  :....|.|...:.:|....|:|. .:|:            |.|  ||.. 
Human   149 GAEVVKQVE---HPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALG--YSKRV 208

  Fly   170 ----------SGHPVEWTEETNYMFRLSQFQDDVRHWVKTEARVRPAKFEK---------ILLDT 215
                      :|..:..:||.:.:..|.: ::||:..:| :|...|...|.         :|...
Human   209 HLMNPMVPGLTGSKMSSSEEESKIDLLDR-KEDVKKKLK-KAFCEPGNVENNGVLSFIKHVLFPL 271

  Fly   216 LSE----------------PLPDVSVSRPSNRVHWAIPVPDDDSQTVYVWLDALVN--------- 255
            .||                ...|:.....:..||     |.|...:|.|.|:.|::         
Human   272 KSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVH-----PGDLKNSVEVALNKLLDPIREKFNTP 331

  Fly   256 ---YLSSVGYPDEKFSAHWPPAQQVIGKDILKFHGIYWTAFLLAAGLEP----PGQLYVHSHWTV 313
               .|:|..|||       |..|:.:.|...|             ..||    |.:|.:..    
Human   332 ALKKLASAAYPD-------PSKQKPMAKGPAK-------------NSEPEEVIPSRLDIRV---- 372

  Fly   314 DGQKMSKSKHNVVDPL--------QAAQQYTMEGLRYFLLREGVAHSDG---NYSHVKAQRILNS 367
             |:.::..||...|.|        :|..:..:.||..|:.:|.:  .|.   ...::|.|::...
Human   373 -GKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEEL--QDRLVVVLCNLKPQKMRGV 434

  Fly   368 ELADTLGNLLSRASAKSLNPGQIYP------SPSAEHL-----------ADLLRSLDVAKRLQDS 415
            |   :.|.||. ||.:.:| .|:.|      |...||:           .:|.....|.::||..
Human   435 E---SQGMLLC-ASIEGIN-RQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQAD 494

  Fly   416 LLQLSERCESHYECNHF 432
             .::||.|.:.::..:|
Human   495 -FKISEECIAQWKQTNF 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907 83/426 (19%)
PRK11893 21..553 CDD:237012 105/520 (20%)
Anticodon_Ia_like 365..503 CDD:299868 20/85 (24%)
YARS1NP_003671.1 nt_trans 8..328 CDD:320711 64/320 (20%)
'HIGH' region 44..52 1/7 (14%)
'KMSKS' region 222..226 0/3 (0%)
PRK12267 <327..528 CDD:330948 46/217 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..363 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.