DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS-m and ARC1

DIOPT Version :10

Sequence 1:NP_650348.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_011410.1 Gene:ARC1 / 852773 SGDID:S000003073 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:28/117 - (23%)
Similarity:43/117 - (36%) Gaps:50/117 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SGHPVEWTEETNYMFRLSQFQDDVRHWVKTEARVRPAKFEKIL--------LDTLSEPLPD---- 222
            |.:||.:|:|.:                     .:.|::|.:|        ||.|:..|.|    
Yeast    14 SKYPVSFTKEQS---------------------AQAAQWESVLKSGQIQPHLDQLNLVLRDNTFI 57

  Fly   223 VSVSRP-SNRVH---WAIPVPDD------DSQTVYV-------WLDALVNYL 257
            ||...| |..||   .|:|:..|      |.::.|.       |:|.:.|.|
Yeast    58 VSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRS-mNP_650348.1 MetG 21..559 CDD:439913 28/117 (24%)
ARC1NP_011410.1 GST_C_Arc1p_N_like 22..119 CDD:198337 24/109 (22%)
PLN02610 <193..376 CDD:215329
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.