DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS-m and ARC1

DIOPT Version :9

Sequence 1:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_011410.1 Gene:ARC1 / 852773 SGDID:S000003073 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:28/117 - (23%)
Similarity:43/117 - (36%) Gaps:50/117 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SGHPVEWTEETNYMFRLSQFQDDVRHWVKTEARVRPAKFEKIL--------LDTLSEPLPD---- 222
            |.:||.:|:|.:                     .:.|::|.:|        ||.|:..|.|    
Yeast    14 SKYPVSFTKEQS---------------------AQAAQWESVLKSGQIQPHLDQLNLVLRDNTFI 57

  Fly   223 VSVSRP-SNRVH---WAIPVPDD------DSQTVYV-------WLDALVNYL 257
            ||...| |..||   .|:|:..|      |.::.|.       |:|.:.|.|
Yeast    58 VSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907 28/117 (24%)
PRK11893 21..553 CDD:237012 28/117 (24%)
Anticodon_Ia_like 365..503 CDD:299868
ARC1NP_011410.1 GST_C_Arc1p_N_like 22..119 CDD:198337 24/109 (22%)
PLN02610 <193..376 CDD:215329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.