DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS-m and aimp1a

DIOPT Version :9

Sequence 1:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001039316.1 Gene:aimp1a / 562232 ZFINID:ZDB-GENE-060825-144 Length:315 Species:Danio rerio


Alignment Length:104 Identity:24/104 - (23%)
Similarity:42/104 - (40%) Gaps:24/104 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 LRLSGIVLQPIIPQLANRLLDK------LSVPTAQRGWNYLAESFATSPNSSNSPAGLGESRQLD 539
            |.:....|:..|.:|..:||||      :.||:.:.....:::..:..|..|.||:...      
Zfish    57 LMVENAKLKKDIEELKKQLLDKEKMRGVIDVPSTEFSVQCVSKPTSADPPVSASPSAAS------ 115

  Fly   540 GQTSALLFQRILEETSAKEVKEQKPQPAKRSKSKKKERR 578
                       .:..|||...|.|...|:: |.:|||::
Zfish   116 -----------TKTPSAKNNDEAKKMKAEK-KGEKKEKK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907
PRK11893 21..553 CDD:237012 14/77 (18%)
Anticodon_Ia_like 365..503 CDD:299868 8/27 (30%)
aimp1aNP_001039316.1 ATP-synt_B <5..81 CDD:304375 8/23 (35%)
tRNA_bind_EMAP-II_like 153..255 CDD:239198
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.