powered by:
Protein Alignment CG9616 and CG34290
DIOPT Version :9
Sequence 1: | NP_650347.2 |
Gene: | CG9616 / 41731 |
FlyBaseID: | FBgn0038214 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097899.2 |
Gene: | CG34290 / 5740609 |
FlyBaseID: | FBgn0085319 |
Length: | 282 |
Species: | Drosophila melanogaster |
Alignment Length: | 31 |
Identity: | 8/31 - (25%) |
Similarity: | 14/31 - (45%) |
Gaps: | 3/31 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 SNEEYPFPKTRITLRHQMTIRVKNKGKYSSY 154
|..:||| .::|:..:|....|...|..:
Fly 46 STSKYPF---MVSLQDVITRNTTNGVSYQHF 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456033 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.