DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9616 and CG9631

DIOPT Version :9

Sequence 1:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:145 Identity:60/145 - (41%)
Similarity:76/145 - (52%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSITLFALLVLCAGPTLG--LLVPQHYCDEHFRYAMKDKQQTYIGIFSAPDEAINSNTVLNWLAT 63
            |:|....||.||....||  |.||||.|:.:|.| .|:....|||:|:||...:||   |:|...
  Fly     1 MTILWLTLLGLCLNLKLGSALHVPQHNCERYFSY-YKEDSGAYIGVFTAPRAGVNS---LSWEVV 61

  Fly    64 FEMQGKRDL-FVGSMNTYPNKNEAAINIVRGMPAEVFVEFLNITNALPKLTSLYLNDQLLCSNEE 127
            |...|..:. .|||:..||||..|...|..|...||||.|.:..|.||||.....|.::||.|||
  Fly    62 FTAHGTGEANTVGSLIPYPNKERAFEKIHSGERGEVFVRFTDFGNELPKLVRAEFNGEVLCQNEE 126

  Fly   128 YPFPKTRITLRHQMT 142
            |..|.:.:|.|..|:
  Fly   127 YDAPSSTMTRRQSMS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9616NP_650347.2 GD_N 24..128 CDD:292649 42/104 (40%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649 42/104 (40%)
Tryp_SPc 198..436 CDD:238113
Tryp_SPc 198..433 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014350
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.