DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9616 and CG11668

DIOPT Version :10

Sequence 1:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:47 Identity:11/47 - (23%)
Similarity:22/47 - (46%) Gaps:5/47 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FVEFLNITNALPKLTSL-----YLNDQLLCSNEEYPFPKTRITLRHQ 140
            :|:.::...|:|::|.|     :.|..:.|.:..|..|...|:...|
  Fly    58 YVDCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9616NP_650347.2 GD_N 24..133 CDD:464985 9/38 (24%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.