powered by:
Protein Alignment CG9616 and CG12951
DIOPT Version :9
Sequence 1: | NP_650347.2 |
Gene: | CG9616 / 41731 |
FlyBaseID: | FBgn0038214 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649880.1 |
Gene: | CG12951 / 41110 |
FlyBaseID: | FBgn0037677 |
Length: | 265 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 10/47 - (21%) |
Similarity: | 17/47 - (36%) |
Gaps: | 12/47 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 FVGSMNTYPNKNEAAINIV------------RGMPAEVFVEFLNITN 107
||.|:.:|...:....:|: .|.||:.......:||
Fly 43 FVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTN 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456021 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.