DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9616 and CG13527

DIOPT Version :9

Sequence 1:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:124 Identity:28/124 - (22%)
Similarity:49/124 - (39%) Gaps:35/124 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCAGPTLGLLVPQHYCDEH-FRYAMKDKQQTY------IGIFSAPDEAIN---SNTVLNWLATFE 65
            :|: |...|.||:::...: |..|:...|:..      ||....|.||..   .:|||.|     
  Fly   110 VCS-PVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGW----- 168

  Fly    66 MQGKRDLFVGSMNTYPNKNEAAINIVRGMPAEVFVEFLNITNALPKLTSLYLNDQLLCS 124
               .|..|.|.:         |::|.:       |:.:.:.||:.|....:..|.::|:
  Fly   169 ---GRMYFGGPL---------AVHIYQ-------VDVVLMDNAVCKTYFRHYGDGMMCA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9616NP_650347.2 GD_N 24..128 CDD:292649 23/111 (21%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 28/124 (23%)
Tryp_SPc 43..263 CDD:214473 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.