DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9616 and CG32260

DIOPT Version :9

Sequence 1:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:151 Identity:32/151 - (21%)
Similarity:51/151 - (33%) Gaps:53/151 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALLVLCAGPTLGLLVPQHYCDEHFRYAMKDKQQTYIGIFSAPDEAINSNTVLNWLATFEMQGKRD 71
            ||..||.|..:           |.||                  .|.|...:|.:.|....|..|
  Fly   355 ALKFLCGGSLI-----------HSRY------------------VITSAHCINPMLTLVRLGAHD 390

  Fly    72 LFVGSMNTYPNKNEAA-INIVRGMPAEVF-----------VEFLNITNALP-KLTSLYLNDQLLC 123
            |      :.|.::.|. :.|.|.:..|.|           :| ||:..||| .::.:.|.:....
  Fly   391 L------SQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIE-LNVVGALPGNISPICLPEAAKF 448

  Fly   124 SNEEY----PFPKTRITLRHQ 140
            ..:::    ||......::||
  Fly   449 MQQDFVGMNPFVAGWGAVKHQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9616NP_650347.2 GD_N 24..128 CDD:292649 23/116 (20%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 32/151 (21%)
Tryp_SPc 328..571 CDD:238113 32/151 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.