DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and f9b

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:436 Identity:107/436 - (24%)
Similarity:163/436 - (37%) Gaps:90/436 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKLGSALHVPQHNCERYFSYYKEDSGAYIGVFTAPRAGVNSLSWEVVFTAHGTGEANTVGSLIPY 79
            |::....||....| .:|....:..||........|..|:..|.|    ..|......:|.:|..
Zfish   125 LEMAKQCHVNNGGC-MHFCIVDKIYGAVCDCAEGYRLAVDGRSCE----PRGQYPCGRLGKIIAQ 184

  Fly    80 PNKERAFEKIHSGERGEVFVRFTDFGNELPKLVRAEFNGEVLCQNEEYDAPSSTMTRRQSM-STS 143
            ....||.|...:..:.:..               :..||      .||:...|:.|....| |||
Zfish   185 TLNSRALESTETVNQNQTI---------------SHING------TEYNTTESSPTDLSEMNSTS 228

  Fly   144 TPISQKSAPREIVRQRRPPPSTPSNDPNPFLPSIMPRIDSDFEECGVEGFSPLQIGGDLVTRGQY 208
            ||.:                |..:...:|.|.:|....::.:.          .:|||....|:.
Zfish   229 TPRN----------------SLQNVSSSPILTNINNTTNNKYR----------IVGGDEAIPGEI 267

  Fly   209 PWLAALYEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLGRHD--RNENPENGASLVS 271
            ||.....|.|....: |..|::|:..|||||||:.||..| .::.:|.||  :.|..|:...:..
Zfish   268 PWQVVFLEKVNKIVF-CGGSLLSEEWVITAAHCVEGKQGS-FFIRVGEHDVSKMEGTESDHGIEE 330

  Fly   272 VTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGS-----NMGLPPNEGDTGAVAGW 331
            ..  :.|.......:.:.|:.||.|..|::...|..|:|| ||     |:   ....:...|:||
Zfish   331 YH--IHPRYNSQRSLYNHDIALLKLKKPVILFDYAVPICL-GSKDFTENL---LQSAENSLVSGW 389

  Fly   332 GYDRSA-------QKTRFPKTVSVRLVPRDQCLKEMKRAEDFITRRTVCAGNSE-SHGPCFGDSG 388
            |..|..       ||...|      .|.|.:|   ...:.|.|:|...|||.|. ....|.||||
Zfish   390 GRLRYGGIESNVLQKVELP------YVDRIKC---KGSSTDSISRFMFCAGYSTVRKDACQGDSG 445

  Fly   389 SALIVLRNNRWYVRGVVSLSPRHGEIC-DLSKYVIYCDVARHIDWV 433
            ........:.|::.|:||    .||.| ...||.||..:::::.|:
Zfish   446 GPHATRYKDTWFLTGIVS----WGEECAKEGKYGIYTRISKYMAWI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649 16/100 (16%)
Tryp_SPc 198..436 CDD:238113 74/252 (29%)
Tryp_SPc 198..433 CDD:214473 73/250 (29%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342 8/36 (22%)
Tryp_SPc 255..487 CDD:214473 73/262 (28%)
Tryp_SPc 256..490 CDD:238113 74/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.