DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG34290

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:279 Identity:71/279 - (25%)
Similarity:116/279 - (41%) Gaps:78/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 IGGDLV-----TRGQYPWLAALYEGVGTAT-------YKCVVSVISKRTVITAAHCIYGKSASQL 250
            :||.:|     :..:||::.:|.:.:...|       :.|..|:||.|.:::||||::.|:...:
  Fly    35 VGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIHYI 99

  Fly   251 WVYLGRHDRNENPENGASL--VSVTSV----LTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPL 309
            ..::|    .||.||...|  ..:.||    ..||.:..      |:.||.:.     .:|    
  Fly   100 AAFIG----YENIENIGQLQPYGLESVEYIYFQPSNFRN------DIALLYMK-----RRY---- 145

  Fly   310 CLW---GSNM--------GLPPNEGDTGAVAGWGYDRSA---QKTRFPKTVSVRLVPRDQCLKEM 360
              |   |:.:        |:.|::.::..:.|:|....|   ||..|  ...||::...:|    
  Fly   146 --WSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLF--EAEVRVIDNQKC---- 202

  Fly   361 KRAEDFITR--------RTVCA-GNSESHGPCFGDSGSALIVLRNNRWYVRGVVSLSPRHGEICD 416
               .|.|..        .|||| ||::.  .|.||||..||.....:.|:.|:||    ||..|.
  Fly   203 ---RDIIGHIWAPQNGANTVCALGNNQD--SCQGDSGGPLICTYGGKDYIYGLVS----HGLTCG 258

  Fly   417 L-SKYVIYCDVARHIDWVR 434
            : ....||.....:.|||:
  Fly   259 IPGMPSIYTVTRPYYDWVQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 71/279 (25%)
Tryp_SPc 198..433 CDD:214473 69/276 (25%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 70/277 (25%)
Tryp_SPc 34..276 CDD:214473 69/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.