DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG4815

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:231 Identity:60/231 - (25%)
Similarity:93/231 - (40%) Gaps:64/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GVGTATYK-----CVVSVISKRTVITAAHC-----------IYGKSASQLWVYLGRHDRNENPEN 265
            |||...:.     |..::::.|.::|||||           |.||||...|     |..|.|.. 
  Fly    48 GVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTW-----HGNNFNKN- 106

  Fly   266 GASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYI--RPLCLWGSNMGLPPNEGDTGAV 328
              .|:.|.  :.|...:...:  |||.:.....|: .:|||  ..||    ...|.|.  |....
  Fly   107 --KLIRVQ--IHPKYAKMKFI--ADVAVAKTKYPL-RSKYIGYAQLC----RSVLHPR--DKLIA 158

  Fly   329 AGWGY-----DRSAQKTRFPKTVSVRLVPRDQCLKEMKRAEDFITRRTVCAGNSESHGPCFGDSG 388
            ||||:     |.|.:||.  :::.|.:|.:..|.|::.|.   :....:|||...:...||||||
  Fly   159 AGWGFEGGVWDESRKKTF--RSMKVGIVSKRDCEKQLDRK---MPPNIICAGAYNNKTLCFGDSG 218

  Fly   389 SALIVLRNNRWYVRGVVSLSPRHGEICDLSKYVIYC 424
            ..|::.|                 ::|.::.:...|
  Fly   219 GPLLLGR-----------------QVCGINTWTFKC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 60/231 (26%)
Tryp_SPc 198..433 CDD:214473 60/231 (26%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 59/230 (26%)
Trypsin 49..256 CDD:278516 59/230 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.