DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG11670

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:328 Identity:88/328 - (26%)
Similarity:139/328 - (42%) Gaps:78/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 SAPREIVRQRRPPPSTPSNDPNPFLPSIMPRID--------------SDFEECGVEGFSPLQIGG 200
            :.||: .:.|||||:...|..|.|| :...::|              .||.            |.
  Fly   123 NGPRQ-WQPRRPPPNHHRNFHNIFL-NTESKVDGENYNKTAETEDLHDDFN------------GR 173

  Fly   201 DLVTRGQYPWLAAL------YEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLG---- 255
            .:|..||||.:|||      :|    ..|||..|:||:..|:|||||:.....|...|.:|    
  Fly   174 SIVAPGQYPHMAALGFRNENHE----IDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKL 234

  Fly   256 -RHDRNENPENGASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLP 319
             ..:.|..|:..    .|..:.....|..: :...|:||:.|..|:.||.::||:.||      |
  Fly   235 KEWELNVAPQRR----RVAQIYLHPLYNAS-LNYHDIGLIQLNRPVEYTWFVRPVRLW------P 288

  Fly   320 PNEGDTGAVAGWGYDRS--AQ-KTRFPKTVSVRLVPRDQCLKEMKRAE----DFITRRTVCAGNS 377
            .|:...|.:...||..:  || :|.....:.:.:||.:||...:...|    ..:|.: :||.:.
  Fly   289 MNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQ-ICAHDY 352

  Fly   378 E-SHGPCFGDSGSALIV-----------LRNNRWYVRGVVSLSPRHGEICDLSKYVIYCDVARHI 430
            | :...|.||||..|.:           .::.|:|:.|:.|    :|..|......:|..|:.:|
  Fly   353 EKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITS----YGAYCRSELPGVYTRVSSYI 413

  Fly   431 DWV 433
            ||:
  Fly   414 DWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 74/266 (28%)
Tryp_SPc 198..433 CDD:214473 73/264 (28%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 74/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.