DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG11668

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:369 Identity:88/369 - (23%)
Similarity:142/369 - (38%) Gaps:102/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NGEVLCQNEEYDAPSSTMTRRQSMSTSTPISQKSAPREIVRQRRPPPSTPSNDPNPFLPSIMPRI 181
            |..|.|.:..|..|.      .|:|.|......:.||...::||...:|            .|::
  Fly    82 NQLVCCPHGGYLLPP------PSISKSEQACANAYPRAHHKRRRRRRNT------------NPKL 128

  Fly   182 DSDFEECGVEGFSP----------LQIGGDLVTRGQYPWLAAL----------YEGVGTA----T 222
            |.      ||...|          |.:||.|....::|::.||          :|. |::    |
  Fly   129 DQ------VELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEH-GSSKRRYT 186

  Fly   223 YKCVVSVISKRTVITAAHC--IYGKSASQLWVYLGRHDRNENPENGASLVSVTSVLTPSAYEGNP 285
            :.|..::|:.|..||||||  :.|:|.|.  ..:|..:.|   .....|:.:..:      ..:|
  Fly   187 FNCGCAMIAPRFAITAAHCASVGGESPSV--ALIGGVELN---SGRGQLIEIKRI------SQHP 240

  Fly   286 VPDADVGLLVLTSPMVYTKYIR----PL-CLWGSNMGLPPNEGDTGAVAGWGYDRSAQKTRFPKT 345
            ..||:    .||:.:...|..|    |: |||... .||..     .:...||.    :|:|...
  Fly   241 HFDAE----TLTNDLAVVKLARRSHMPVACLWNQE-SLPER-----PLTALGYG----QTKFAGP 291

  Fly   346 VSVRLVP-------RDQC---LKEMKRAEDFITRRTVCAGN-SESHGPCFGDSGSALIV---LRN 396
            .|..|:.       ..||   |....:..:.:....:|||: |.:...|.||||..|::   :|:
  Fly   292 HSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRH 356

  Fly   397 NRW---YVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWVRQNM 437
            :|.   ||.|:.|.    |..|...:..:|..:|.:|.|:.|.:
  Fly   357 HRHTIPYVVGITSF----GGACASGQPGVYVRIAHYIQWIEQQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649 3/9 (33%)
Tryp_SPc 198..436 CDD:238113 68/275 (25%)
Tryp_SPc 198..433 CDD:214473 67/272 (25%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 68/275 (25%)
Tryp_SPc 149..392 CDD:214473 67/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.