DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG16749

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:242 Identity:69/242 - (28%)
Similarity:118/242 - (48%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 QYPWLAALYEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLGRHDRNENPENGASLVS 271
            :||::.::....|  ::.|..|:|||:.|:|||||..|:.||.|.|..|....|   ..|.::|.
  Fly    40 KYPFVISMRGSSG--SHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKIN---ATGPNVVR 99

  Fly   272 VTSVLTPSAYEGNPVPD--ADVGLLVLTSPMVYTKY-IRPLCLWGSNMGLPPNE-GDTGAVAGWG 332
            |..::....|  ||..:  .|:.||::..|..:... :.|:.|.......|..: |..|.:.|||
  Fly   100 VKKIIQHEDY--NPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG 162

  Fly   333 YDRSA---QKTRFPKTVSVRLVPRDQCLKEMKRAEDFITRRTVCAGNSE-SHGPCFGDSGSALIV 393
            .:.:.   |.|.  :.|.:::...::|.:......|  .|..:|.|..| ..|.|.||||..||.
  Fly   163 LNATGGYIQSTL--QEVELKVYSDEECTERHGGRTD--PRYHICGGVDEGGKGQCSGDSGGPLIY 223

  Fly   394 LRNNRWYVRGVVSLSPRHGEICDLSKYV-IYCDVARHIDWVRQNMVM 439
               |...| |:||.|.:.   |.::.|. :||.|::::||::::.::
  Fly   224 ---NGQQV-GIVSWSIKP---CTVAPYPGVYCKVSQYVDWIKKSQII 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 69/237 (29%)
Tryp_SPc 198..433 CDD:214473 68/234 (29%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 68/234 (29%)
Tryp_SPc 30..259 CDD:238113 69/236 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.