DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG3650

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:276 Identity:72/276 - (26%)
Similarity:118/276 - (42%) Gaps:83/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IMPRIDSDFEECGVEGFSPLQIGGDLVTRGQYPWLAAL--------YEGVGTATYKCVVSVISKR 233
            |.|||                :||...|      |:|:        |:|    |:.|..|:::..
  Fly    22 IQPRI----------------VGGTTTT------LSAVGGFVVNLRYDG----TFYCGGSLVTSS 60

  Fly   234 TVITAAHCIYGKSASQLWVYLGRHDRNENPENGASLVSVTSVL-------TPSAYEGNPVPDADV 291
            .|:|||||:.|..||::.|           :.|.|.:|.:.|:       .|:.:..:.: :.||
  Fly    61 HVVTAAHCLKGYQASRITV-----------QGGVSKLSQSGVVRRVARYFIPNGFSSSSL-NWDV 113

  Fly   292 GLLVLTSPMVYTKYIR-PLC--LWGSNMGLPPNEGDTGAVAGWG---YDRSAQKTRFPKTVSVRL 350
            |::.|.|.:..:.... |||  .|        |.|:...|:|||   |..|:...:. :||.::|
  Fly   114 GVIRLQSALTGSGITTIPLCQVQW--------NPGNYMRVSGWGTTRYGNSSPSNQL-RTVRIQL 169

  Fly   351 VPRDQCLKEMKRAEDFITRRTVCA--GNSESHGPCFGDSGSALIVLRNNRWYVRGVVSLSPRHGE 413
            :.:..| :...:..|.:|..|.||  |..:|   |.||||.. ::.:|.   :.|:||    .|.
  Fly   170 IRKKVC-QRAYQGRDTLTASTFCARTGGKDS---CSGDSGGG-VIFKNQ---LCGIVS----WGL 222

  Fly   414 ICDLSKYV-IYCDVAR 428
            .|..::|. :|..|.|
  Fly   223 GCANAQYPGVYTSVHR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 68/255 (27%)
Tryp_SPc 198..433 CDD:214473 68/255 (27%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 70/273 (26%)
Tryp_SPc 26..243 CDD:238113 69/272 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.