DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG3700

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:276 Identity:68/276 - (24%)
Similarity:113/276 - (40%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 SPLQIGGDLVTRGQYPWLAALYEGVGT---------ATYKCVVSVISKRTVITAAHCIYGKSAS- 248
            :|..:||...:..::|::|.    :||         ..:.|..||:..:.|:|||||:....:. 
  Fly    99 TPFIVGGTKASGKEFPFMAL----IGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKA 159

  Fly   249 ----------QLWVYLGRHDRNENPENGASLVSVTSVLTPSAYEGNPVPDA------DVGLLVLT 297
                      :..|.||..|.|...::  :||....|:....:.|....|.      |:.|:.|.
  Fly   160 ERLDPNFDSPKFVVRLGELDYNSTTDD--ALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222

  Fly   298 SPMVYTKYIRPLCLWGSNMGLPPNEG-DTGAV--AGWGYDRSAQKTRFPKTVSVRLVPRDQCLKE 359
            ....:..::..:|       |||:.| |...|  ||||:.....|:.....|:::....:.|.|.
  Fly   223 RKAEFNDHVAAVC-------LPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKR 280

  Fly   360 MKRAEDFITRRTVCAGNSESHG-PCFGDSGSALIVLRNNRWY-----VRGVVSLSPRHGEICDLS 418
            ::.:.|  ||...|||:..|.. .|.||||..:.|  .:..|     |.|:||    :|.:|...
  Fly   281 LRFSID--TRTQFCAGSMSSQADTCNGDSGGPIFV--QHPLYPCLKQVIGIVS----YGLVCGSQ 337

  Fly   419 KY-VIYCDVARHIDWV 433
            .. .:|..|..:.||:
  Fly   338 GLPSVYTKVHLYTDWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 67/272 (25%)
Tryp_SPc 198..433 CDD:214473 66/270 (24%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/273 (25%)
Tryp_SPc 102..353 CDD:214473 66/271 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.