DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and CG1773

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:294 Identity:71/294 - (24%)
Similarity:109/294 - (37%) Gaps:74/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EECGV-EGFSPLQ------IGGDLVTRGQYPWLAALYEGVGTATYKCVVSVISKRTVITAAHCI- 242
            ::||| ....|.|      .||...:....||:|.|:........:|..|::|:..|:|||||. 
  Fly    44 QDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFK 108

  Fly   243 YGKSASQLWVYLGRHDRNENPENGASLVSVTSVLTPSAYE---GNPV------------------ 286
            ....:.::.|:||..|           :|.||......|:   ..||                  
  Fly   109 MCPRSKEIRVWLGELD-----------ISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFY 162

  Fly   287 PDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLPPNE---------GDTGAVAGWGYDRSAQKTRF 342
            |..|:.|:.|...:|:..:|||:|       ||..:         |.:....|||   ..:..||
  Fly   163 PGYDIALIKLNKKVVFKDHIRPIC-------LPLTDELLAFTLQLGQSYMAVGWG---RTESRRF 217

  Fly   343 PKTVSVRLVPRDQCLKEMKRAEDFITRRTVCAGNSESHGPCFGDSGSALI----VLRNNRWYVRG 403
            ..:.....:..::|..  .|...|:     || |.:....|.||||..||    :....|....|
  Fly   218 ANSTMEVHINTEKCTD--GRDTSFL-----CA-NGDYVDTCTGDSGGPLIWKTTLFGKARTVQFG 274

  Fly   404 VVSLSPRHGEICDLSKYVIYCDVARHIDWVRQNM 437
            |||...::   |...:...|.||..::.|:...|
  Fly   275 VVSTGSQN---CGAGQKAYYMDVPTYVPWILAKM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 65/272 (24%)
Tryp_SPc 198..433 CDD:214473 64/269 (24%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 64/271 (24%)
Tryp_SPc 62..301 CDD:238113 64/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.