DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and l(2)k05911

DIOPT Version :10

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:42 Identity:10/42 - (23%)
Similarity:19/42 - (45%) Gaps:13/42 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LEAMFGLKTYVAPDDTPMLMVEPPANTHAPVIVTTTMEPAIQ 120
            :..::.|:.|:   |.|:.|::          |..||..|:|
  Fly    48 VSTVWTLRKYI---DDPIHMMK----------VLITMGTAVQ 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..132 CDD:464985 10/42 (24%)
Tryp_SPc 198..436 CDD:238113
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
PTZ00449 <198..>376 CDD:185628
Tryp_SPc 400..637 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.