| Sequence 1: | NP_650345.1 | Gene: | CG9631 / 41729 | FlyBaseID: | FBgn0027563 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_723797.3 | Gene: | l(2)k05911 / 34731 | FlyBaseID: | FBgn0284244 | Length: | 639 | Species: | Drosophila melanogaster |
| Alignment Length: | 42 | Identity: | 10/42 - (23%) |
|---|---|---|---|
| Similarity: | 19/42 - (45%) | Gaps: | 13/42 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 79 LEAMFGLKTYVAPDDTPMLMVEPPANTHAPVIVTTTMEPAIQ 120 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9631 | NP_650345.1 | GD_N | 26..132 | CDD:464985 | 10/42 (24%) |
| Tryp_SPc | 198..436 | CDD:238113 | |||
| l(2)k05911 | NP_723797.3 | CLIP | 111..174 | CDD:197829 | |
| PTZ00449 | <198..>376 | CDD:185628 | |||
| Tryp_SPc | 400..637 | CDD:238113 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||