DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and Tpsg1

DIOPT Version :10

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:181 Identity:30/181 - (16%)
Similarity:50/181 - (27%) Gaps:77/181 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DNPGINTKSCEG--------YLMEECACV--------QRRSVN---------------------- 59
            |||.|....|.|        ||::.|:.|        ||..||                      
Mouse     7 DNPNIQGVRCPGMWPAPSNHYLVKPCSMVKGIPKSGSQRSIVNKGGRLLLLALLTPPPWSALKPV 71

  Fly    60 -------------------FEYDCHCCKN-------QTRPKRTVPL--------EAMFG---LKT 87
                               |..:|..|::       ....::.|.:        |.::|   :|.
Mouse    72 KMALVPVYCLCRQPYNVNHFMIECDLCQDWFHGSCVGIEEEKAVDIDIYHCPDCEVIYGPSIMKK 136

  Fly    88 YVAPDDTPMLMVEPPANTHAPVIVTTTMEPAIQF--QTLRKPNGLCGKLEF 136
            :.|.......:...|..|.:|:.:..........  :.:.||.|....:||
Mouse   137 WPASSKEHEALKREPVKTGSPIFIHQLQGKTFDSSDEVILKPTGSQLTVEF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..132 CDD:464985 28/175 (16%)
Tryp_SPc 198..436 CDD:238113
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 16/101 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.