| Sequence 1: | NP_650345.1 | Gene: | CG9631 / 41729 | FlyBaseID: | FBgn0027563 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006524421.1 | Gene: | Tpsg1 / 26945 | MGIID: | 1349391 | Length: | 368 | Species: | Mus musculus |
| Alignment Length: | 181 | Identity: | 30/181 - (16%) |
|---|---|---|---|
| Similarity: | 50/181 - (27%) | Gaps: | 77/181 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 33 DNPGINTKSCEG--------YLMEECACV--------QRRSVN---------------------- 59
Fly 60 -------------------FEYDCHCCKN-------QTRPKRTVPL--------EAMFG---LKT 87
Fly 88 YVAPDDTPMLMVEPPANTHAPVIVTTTMEPAIQF--QTLRKPNGLCGKLEF 136 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9631 | NP_650345.1 | GD_N | 26..132 | CDD:464985 | 28/175 (16%) |
| Tryp_SPc | 198..436 | CDD:238113 | |||
| Tpsg1 | XP_006524421.1 | Tryp_SPc | 87..317 | CDD:238113 | 16/101 (16%) |
| Blue background indicates that the domain is not in the aligned region. | |||||