DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9631 and try-5

DIOPT Version :9

Sequence 1:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:290 Identity:59/290 - (20%)
Similarity:97/290 - (33%) Gaps:81/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PWLAALYEGVGTATYK--CVVSVISKRTVITAAHCIY---------GKSASQLWVYLGRHDR--- 259
            ||...:........::  |..::|:.:.|:|||||..         |:..|....|...:.|   
 Worm    55 PWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTD 119

  Fly   260 -------------------------NENPENGASL----VSVTSVLTPSAYEGNPVPDADVGLLV 295
                                     ||. :||.:|    .::.........:||     |:.:|.
 Worm   120 SEILTRTVVTVGAMCTRLEQKYGCVNEK-QNGKTLKISRFAIGDFYKTHCEQGN-----DIVILE 178

  Fly   296 LTSPMVYTKYIRPLCLWGSNMGLPPNEGDTGAVA---GWGYD--RSAQKTRFPKTVSVRLVPRDQ 355
            |.|.:...:.....||    ..||.....:||..   |||.|  :......||....:.|.....
 Worm   179 LESTIDDVEGANYACL----PFLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLTLATETL 239

  Fly   356 CLKEMKRAEDF---ITRRTVCAGNSESHGPCFGDSGSALIVLRNN--RWYVRGVVSLSPRHGEIC 415
            ...|    |::   |...:.|....|....|.||||..|...:::  |.::..:||    :|..|
 Worm   240 ATCE----ENWGTSIPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVS----YGSDC 296

  Fly   416 ------DLSKYVIYCDVARH----IDWVRQ 435
                  ...:..|..||.:|    ::::.|
 Worm   297 VQLIGGSEPRSQINTDVRKHQKFIVNFINQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 59/290 (20%)
Tryp_SPc 198..433 CDD:214473 58/286 (20%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 53/258 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.