DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG18754

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:301 Identity:85/301 - (28%)
Similarity:122/301 - (40%) Gaps:81/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 DLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQL---PWLV-AIFERRESNGPAFICGGTLI 309
            |::|      |...||:    ||| :|:.:..:..:|   ||:| .::|.|.|          ||
  Fly    89 DVLP------NKQTCGQ----TTP-VFRDRGAENAELNEYPWMVLLLYENRLS----------LI 132

  Fly   310 STSTVLSAAHCFRAPGRDLPASRL---AVSLGRNTL--------AIHSDGEFRGVSQLIIHENFQ 363
              ..||:||||  ..|..|..:.|   :|.||.:|.        ..|.|.|   |.|..:|:.|.
  Fly   133 --RYVLTAAHC--VIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVE---VGQTTVHQGFT 190

  Fly   364 FKQFT-EADLALVRLDEPVRYTDYIVPICLWSTSNRMDLP-QGLKSYVAGWGPDETGTGNTEVSK 426
            ....| ..|:||:||..|||||..|.||||...    :.| |.|...::||.|       |:.|:
  Fly   191 SSGGTYRNDIALLRLQFPVRYTKKIQPICLLDA----EFPLQDLNLQISGWDP-------TKSSQ 244

  Fly   427 VTDLNIVSE---ANCALELPHVLVQPSSLCAKKTGAG-PCASDGGGPLMLREQDVWVLRGVISGG 487
            ....:.|.|   |:|....|. ....|.:||.....| .||...|.|:|          |::..|
  Fly   245 TLITSTVKERNPADCLNRYPS-FRSASQVCAGGQRKGDTCAGISGSPVM----------GIMGSG 298

  Fly   488 V---------INEKENTC-ELSKPSVFTDVAKHIEWVRQKM 518
            |         .:..:..| ....|.|:|.:....||::..:
  Fly   299 VDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 76/270 (28%)
Tryp_SPc 277..514 CDD:214473 75/267 (28%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 76/268 (28%)
Tryp_SPc 108..335 CDD:214473 75/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.