DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and AZU1

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:270 Identity:74/270 - (27%)
Similarity:111/270 - (41%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 RASTTPL--IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRA--PGRD 327
            ||.::||  |..|:..:..|.|:|.:|    ::.|..| |||.||....|::||.||::  ||..
Human    18 RAGSSPLLDIVGGRKARPRQFPFLASI----QNQGRHF-CGGALIHARFVMTAASCFQSQNPGVS 77

  Fly   328 LPASRLAVSLG-----------RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPV 381
                  .|.||           |.|.:|.|           :.||....|....||.|::||...
Human    78 ------TVVLGAYDLRRRERQSRQTFSISS-----------MSENGYDPQQNLNDLMLLQLDREA 125

  Fly   382 RYTD--YIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPH 444
            ..|.  .|:|:.|.:.:    :..|.:..|||||...:|...:...:..::.:..|..|      
Human   126 NLTSSVTILPLPLQNAT----VEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC------ 180

  Fly   445 VLVQPSSLCAKKTG-----AGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVF 504
               :|:::|   ||     .|.|..|||.||        |..| ::.||.:.....|... |..|
Human   181 ---RPNNVC---TGVLTRRGGICNGDGGTPL--------VCEG-LAHGVASFSLGPCGRG-PDFF 229

  Fly   505 TDVAKHIEWV 514
            |.||...:|:
Human   230 TRVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 69/258 (27%)
Tryp_SPc 277..514 CDD:214473 68/256 (27%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 70/261 (27%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.