DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Prss33

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:270 Identity:83/270 - (30%)
Similarity:131/270 - (48%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRD 327
            ||:.|.|:.  |..|:..|.|:.||..:|..|     .|.:|||:||:...||:|.|||..  |.
  Rat    25 CGQPRMSSR--IVGGRDAQDGEWPWQTSIQHR-----GAHVCGGSLIAPQWVLTAGHCFSR--RV 80

  Fly   328 LPASRLAVSLGRNTLAIHSDGEFR-GVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPIC 391
            || |..:|.||..:|.:.|..|.. .|.::::..::. :.....||||::|..||..:..|.|:|
  Rat    81 LP-SEYSVLLGALSLDVTSSHELLVPVLRVLLPPDYS-EDEARGDLALLQLSHPVSLSARIQPVC 143

  Fly   392 LWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNI-VSEANCALELPHV---------L 446
            |.:..:..  |.|...:|.|||....|....:...:..:.: :.::.....|.|:         :
  Rat   144 LPAPGSHP--PPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGANVPKSERI 206

  Fly   447 VQPSSLCA--KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCEL-SKPSVFTDVA 508
            |.|.:|||  ::.....|..|.||||...|...|||.||:|.|      ..|.| ::|.|:|:||
  Rat   207 VLPGNLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSWG------KGCALPNRPGVYTNVA 265

  Fly   509 KHIEWVRQKM 518
            |:..|::.::
  Rat   266 KYSPWIQARL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 78/253 (31%)
Tryp_SPc 277..514 CDD:214473 77/250 (31%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 78/256 (30%)
Tryp_SPc 34..272 CDD:238113 79/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.