DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and AgaP_AGAP000411

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_001237291.3 Gene:AgaP_AGAP000411 / 4576124 VectorBaseID:AGAP000411 Length:1091 Species:Anopheles gambiae


Alignment Length:273 Identity:71/273 - (26%)
Similarity:132/273 - (48%) Gaps:16/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 QQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSA 317
            |.....:.:.|||.:..||.||..|.....|..||..|||.:::.: ..:.|||:::..:|:|:|
Mosquito     2 QTRAQEDHLSCGRRKVKTTYLIHNGADAIAGHWPWHAAIFHQKDKH-KEYACGGSILDETTILTA 65

  Fly   318 AHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFR---GVSQLIIHENFQFKQFTEADLALVRLDE 379
            :||.......:.|:.:.|.:|:  :.::...|:.   ...::||:..|. |.....|:||::|..
Mosquito    66 SHCVSTLSGVISAALVTVHVGQ--IHLNQSSEYTQTFEAREIIINPGFS-KASIIHDIALIKLRT 127

  Fly   380 PVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANC-----A 439
            .:....|:.|:|||:..:.::|..|....:.|:|..|....:.::.:.| :.:|....|     .
Mosquito   128 NISMNRYVQPVCLWTMDSALELIVGRNGTIVGFGLSERDVVSEQLKQAT-IGVVDPYTCIASDRV 191

  Fly   440 LELPHVLVQPSSLCAK-KTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSV 503
            :...|:.::  ..|.| :.|...|..|.||.:.......|.:||::|..........|:..|.:|
Mosquito   192 VYGTHLTLE--MFCGKGQNGVSACNGDSGGGMFFEVSGRWFVRGLVSFTPARGSSGLCDPLKYTV 254

  Fly   504 FTDVAKHIEWVRQ 516
            :|||||::||::|
Mosquito   255 YTDVAKYVEWIKQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 63/249 (25%)
Tryp_SPc 277..514 CDD:214473 61/245 (25%)
AgaP_AGAP000411XP_001237291.3 Tryp_SPc 23..267 CDD:238113 63/250 (25%)
Tryp_SPc 25..265 CDD:214473 61/246 (25%)
Tryp_SPc 308..>462 CDD:304450
Trypsin 838..1069 CDD:278516
Tryp_SPc 864..>946 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 145 1.000 Domainoid score I9368
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9620
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X174
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.