DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:298 Identity:70/298 - (23%)
Similarity:123/298 - (41%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 PTPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFER 294
            |||.       |:.|.:||..|..|...:||.|.           ::||      :|::|.:...
  Fly    18 PTPE-------QKLVPTPVKDVKIQGRITNGYPA-----------YEGK------VPYIVGLLFS 58

  Fly   295 RESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIH 359
            ...|   :.|||::|..:.||:||||...      ||.:.::.|.:.........:.|....:.|
  Fly    59 GNGN---WWCGGSIIGNTWVLTAAHCTNG------ASGVTINYGASLRNQPQYTHWVGSGNFVQH 114

  Fly   360 ENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQ---------GLKSYVAGWGPD 415
            .::..... ..|::|:|    ..:.|:      |...|:::||.         |..:..:|||..
  Fly   115 HHYNSGNL-HNDISLIR----TPHVDF------WHLVNKVELPSYNDRYQDYAGWWAVASGWGGT 168

  Fly   416 ETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGA-GPCASDGGGPLMLREQD--V 477
            ..|:...:..:..|:.|:|:::|:....   :..:.:|....|. ..|..|.||||:..|.:  |
  Fly   169 YDGSPLPDWLQAVDVQIMSQSDCSRTWS---LHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLV 230

  Fly   478 WVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            .|...|.|.|        |:...|:||:.|..:::|:|
  Fly   231 GVTSFVSSAG--------CQSGAPAVFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 58/251 (23%)
Tryp_SPc 277..514 CDD:214473 56/248 (23%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 59/269 (22%)
Tryp_SPc 38..262 CDD:238113 61/271 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.