DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG9737

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:289 Identity:82/289 - (28%)
Similarity:130/289 - (44%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPG-R 326
            ||::   .|..|:.|:..:..:.|||..:.......|    |.|.||....:|:||||.:..| |
  Fly   142 CGKQ---VTNRIYGGEIAELDEFPWLALLVYNSNDYG----CSGALIDDRHILTAAHCVQGEGVR 199

  Fly   327 DLPASRLAVSLGRNTLAIHSD-----------GEFRGVSQLIIHENFQFKQFTE---ADLALVRL 377
            |....: .|.||...:....|           .....::...||.:.::|:|:.   .|:|::||
  Fly   200 DRQGLK-HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL 263

  Fly   378 DEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALEL 442
            ..||.:|.:::||||.:.|..:.|.:|....|:||       |.|::.....:||.|.....|.:
  Fly   264 KHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGW-------GRTDLFNKYFINIHSPIKLKLRI 321

  Fly   443 PH--------------VLVQPSSLC-----AKKTGAGPCASDGGGPLML--REQDVWVLRGVISG 486
            |:              |.:.|..:|     ||.|    ||.|.|||||.  |:...||..||:|.
  Fly   322 PYVSNENCTKILEGFGVRLGPKQICAGGEFAKDT----CAGDSGGPLMYFDRQHSRWVAYGVVSY 382

  Fly   487 GVINEKENTCELS-KPSVFTDVAKHIEWV 514
            |.     ..|.:: ||:|:|:||::.:|:
  Fly   383 GF-----TQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 78/275 (28%)
Tryp_SPc 277..514 CDD:214473 77/273 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 78/277 (28%)
Tryp_SPc 150..409 CDD:238113 79/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.